PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g056790.1.1
Common NameSlSRN1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 591aa    MW: 66500.3 Da    PI: 4.6555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g056790.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.41.7e-50231492128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         ppGfrFhPtdeelv +yLkkk+ gk++ l ++i+e+d+yk+eP+dLp  +k+k+++++w+fFs+rd+ky++g r+nr tk+g Wk tgkd+
  Solyc12g056790.1.1  23 PPGFRFHPTDEELVLYYLKKKICGKRILL-DAIAETDVYKWEPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARANRGTKRGHWKVTGKDR 112
                         9*************************999.99**************96559999************************************* PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++ ++++vglkktLvfykgrap ge+tdWvmhey++
  Solyc12g056790.1.1 113 IIMC-NSRAVGLKKTLVFYKGRAPVGERTDWVMHEYTM 149
                         ****.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-5917172IPR003441NAC domain
PROSITE profilePS5100555.15622172IPR003441NAC domain
PfamPF023658.9E-2623148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MKMFELSDSD SFAVFASSKN VFPPGFRFHP TDEELVLYYL KKKICGKRIL LDAIAETDVY  60
KWEPEDLPDL SKLKTGDRQW FFFSPRDRKY PNGARANRGT KRGHWKVTGK DRIIMCNSRA  120
VGLKKTLVFY KGRAPVGERT DWVMHEYTMD EEELKKCQNA QDYYALYKVF KKSGSGPKNG  180
EQYGAPFREE EWADDECPSA KGFVHQDNST NHVIEAPSVD GGLEELLNPV LMEPLSVDYD  240
YAVEQLVQEE DTRSTLLYHS AKEVNFPHRS AVIAPAKESF DLTQSGTSQR QLHEALEVTS  300
APVIYEQQPH VVEEDFLEMD DLLGPEPSTQ NFDNLGPCVQ NFDEAGQSGQ NFDMPAGNFE  360
DLPFDYFDGL AEFDLYHDAS LLDDVRTTEV GQNTEPHMNN LVNGSVNPAS TTYINTFQHE  420
MMNNQPMYLN NSEQISNQLW VHDQRFNISY PSEANQLVAP PATSGVVYDS ILANHPMDAN  480
QNQLPNQDEG TPSWLTSQLW AFVDSIPTAP AIAAESPVVN SAFKRMSSFS KMRINARNMN  540
VAAAGNTATS RSSRYSKNGL FYFSFVGILC AILCVLLGTF VDILRRPISS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-462214915140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.25830.0callus| cell culture| flower| fruit| leaf
Function -- GeneRIF ? help Back to Top
  1. SlSRN1 is a positive regulator of defense response against B. cinerea and Pst DC3000 but is a negative regulator for oxidative and drought stress response in tomato.
    [PMID: 25010573]
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135490.0Lycopersicon esculentum clone 132273F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304297.10.0stress-related NAC1
TrEMBLK4DG100.0K4DG10_SOLLC; Uncharacterized protein
STRINGSolyc12g056790.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Representative plantOGRP9932711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-133NAC domain containing protein 17
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Liu B, et al.
    Tomato NAC transcription factor SlSRN1 positively regulates defense response against biotic stress but negatively regulates abiotic stress response.
    PLoS ONE, 2014. 9(7): p. e102067
    [PMID:25010573]